The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.1.1 [Aug-8-2000]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig16.seq Contig16
         (579 letters)

Database: nr
           565,281 sequences; 177,575,912 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A26330  hypothetical protein 1 - fruit fly (Drosophila ...    32  5.1

>pir||A26330 hypothetical protein 1 - fruit fly (Drosophila melanogaster)
           transposon I factor
 gb|AAA70221.1| (M14954) I factor [Drosophila melanogaster]
          Length = 426

 Score = 32.1 bits (71), Expect = 5.1
 Identities = 14/55 (25%), Positives = 30/55 (54%)
 Frame = -1

Query: 519 SRSTNNKLPQSIGPTHTQLGLKSHSYKHHKNYPKIENVSSFRTKQQQPSLRWQQR 355
           +++T+ K P +     T L  + H + HH +Y K+E++ +  T  ++PS  +  +
Sbjct: 327 AQNTSAKTPTTEPAKTTLLSNQPHQHHHHHSYDKLEDMDTDYTPTRKPSTTYSSQ 381



  Database: nr
    Posted date:  Sep 29, 2000  9:53 PM
  Number of letters in database: 177,575,912
  Number of sequences in database:  565,281
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.270   0.0470 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 124550601
Number of Sequences: 565281
Number of extensions: 1723765
Number of successful extensions: 4868
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4867
Number of HSP's gapped (non-prelim): 1
length of query: 193
length of database: 177,575,912
effective HSP length: 52
effective length of query: 140
effective length of database: 148,181,300
effective search space: 20745382000
effective search space used: 20745382000
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 69 (31.3 bits)