The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.1.1 [Aug-8-2000]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig352.seq Contig352
         (1160 letters)

Database: nr
           565,281 sequences; 177,575,912 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAA88118.1|  (AB015346) Eps15R [Homo sapiens] >gi|665059...    33  7.0
emb|CAA09657.1|  (AJ011500) gra-orf30 [Streptomyces violaceo...    32  9.2

>dbj|BAA88118.1| (AB015346) Eps15R [Homo sapiens]
 gb|AAF21930.1| (AF110265) epidermal growth factor receptor substrate EPS15R [Homo
           sapiens]
          Length = 864

 Score = 32.8 bits (73), Expect = 7.0
 Identities = 18/36 (50%), Positives = 21/36 (58%)
 Frame = -3

Query: 561 APVAPGTAAGKSAAVMQNLSVLGTADHVGAPEPFQP 454
           AP  P   +GKS  V Q    LG+AD   AP+PFQP
Sbjct: 785 APPRPKPPSGKSTPVSQ----LGSADFPEAPDPFQP 816



>emb|CAA09657.1| (AJ011500) gra-orf30 [Streptomyces violaceoruber]
          Length = 282

 Score = 32.5 bits (72), Expect = 9.2
 Identities = 25/67 (37%), Positives = 29/67 (42%), Gaps = 1/67 (1%)
 Frame = +3

Query: 957  PWDHQPE-RDGQPASGCWDHRRPESVKSRIGGRSFGEHPRPARALALSGCTPNGRRGVAY 1133
            PW  + + R G P  GC        V+S  GG   GE P   RA       P GR G A+
Sbjct: 35   PWLARGDGRVGTPGDGCG-----LCVESGYGGVGVGERPAFTRA-------PGGREGEAH 82

Query: 1134 WRWLPRAE 1157
             RW   AE
Sbjct: 83   LRWAAFAE 90



  Database: nr
    Posted date:  Sep 29, 2000  9:53 PM
  Number of letters in database: 177,575,912
  Number of sequences in database:  565,281
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.270   0.0470 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 320980662
Number of Sequences: 565281
Number of extensions: 6284510
Number of successful extensions: 20970
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 20970
Number of HSP's gapped (non-prelim): 2
length of query: 386
length of database: 177,575,912
effective HSP length: 54
effective length of query: 332
effective length of database: 147,050,738
effective search space: 48820845016
effective search space used: 48820845016
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.8 bits)
X3: 64 (24.9 bits)
S1: 41 (21.7 bits)
S2: 72 (32.5 bits)