BLASTX 2.1.3 [Apr-1-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query=
/home/local/jxu/web/Fgr/NCPvsCOGs/blast/0941_G07_M13ZS5.seq
         (857 letters)

Database: COGs
           78,847 sequences; 26,228,252 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

SLR1293 slr1293  COG1233 [Q] Phytoene dehydrogenase and related ...    31  2.4

>SLR1293 slr1293  COG1233 [Q] Phytoene dehydrogenase and related
           proteins
          Length = 507

 Score = 31.2 bits (69), Expect = 2.4
 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +1

Query: 241 SATGRKQEFLTASSQGFTGGEGDRLRV-GPSSFPPR 345
           SAT R  +  TA  QG  GG G RL   GP  F PR
Sbjct: 431 SATPRTFDRYTARDQGIVGGVGQRLTTFGPFGFAPR 466



  Database: COGs
    Posted date:  Jan 30, 2002  4:01 PM
  Number of letters in database: 26,228,252
  Number of sequences in database:  78,847
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24529075
Number of Sequences: 78847
Number of extensions: 375665
Number of successful extensions: 801
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 797
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 801
length of query: 285
length of database: 26,228,252
effective HSP length: 49
effective length of query: 236
effective length of database: 22,364,749
effective search space: 5278080764
effective search space used: 5278080764
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)