BLASTX 2.1.3 [Apr-1-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query=
/home/local/jxu/web/Fgr/NCPvsCOGs/blast/0941_G09_M17ZS5.seq
         (1004 letters)

Database: COGs
           78,847 sequences; 26,228,252 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

AF0333 AF0333  COG2368 [Q] Aromatic ring hydroxylase                   32  1.7

>AF0333 AF0333  COG2368 [Q] Aromatic ring hydroxylase
          Length = 500

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 19/56 (33%), Positives = 28/56 (49%)
 Frame = +2

Query: 143 STPPHSQCLDNPPDFTAARVEAGKVVLFFAGYKAYVTGAIHSDQAVFLPSDVYGFE 310
           S  PH Q     PD     VE  +  +   G KA++TGA++S + + LP+   G E
Sbjct: 159 SLRPHQQA---DPDVYVRVVERREDGIVVRGAKAHITGAVNSHEIIALPTRAMGEE 211



  Database: COGs
    Posted date:  Jan 30, 2002  4:01 PM
  Number of letters in database: 26,228,252
  Number of sequences in database:  78,847
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36529288
Number of Sequences: 78847
Number of extensions: 638493
Number of successful extensions: 1518
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1495
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1518
length of query: 334
length of database: 26,228,252
effective HSP length: 49
effective length of query: 285
effective length of database: 22,364,749
effective search space: 6373953465
effective search space used: 6373953465
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)