BLASTX 2.1.3 [Apr-1-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query=
/home/local/jxu/web/Fgr/NCPvsCOGs/blast/1605_A08_A15ZS5.seq
         (949 letters)

Database: COGs
           78,847 sequences; 26,228,252 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

RV2643_1 Rv2643_1  COG0798 [P] Arsenite efflux pump ACR3 and rel...    31  2.7

>RV2643_1 Rv2643_1  COG0798 [P] Arsenite efflux pump ACR3 and
           related permeases
          Length = 350

 Score = 31.2 bits (69), Expect = 2.7
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 5/36 (13%)
 Frame = +2

Query: 545 GERRPSTDWFASR-----GPWCLWGTIYWILCILAL 637
           GE+    +W+ SR     GPW L+G ++ I+ + AL
Sbjct: 216 GEKTKGRNWYESRFLPKVGPWALYGLLFTIVILFAL 251



  Database: COGs
    Posted date:  Jan 30, 2002  4:01 PM
  Number of letters in database: 26,228,252
  Number of sequences in database:  78,847
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28147159
Number of Sequences: 78847
Number of extensions: 582101
Number of successful extensions: 1348
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1328
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1348
length of query: 316
length of database: 26,228,252
effective HSP length: 49
effective length of query: 266
effective length of database: 22,364,749
effective search space: 5949023234
effective search space used: 5949023234
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)