The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.2 [Dec-14-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FgrNT3_0_A01.seq Fgr_0_A01 LENGTH:177bp ; DIRECTION:5 ;
CLONE:Fgr_0_A01 ; CLONELIB: n/a ; TISSUE:
         (177 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF
           907,641 sequences; 284,333,007 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_064155.1|  (NC_002512) pR49 [rat cytomegalovirus Maas...    30   8.0  

>ref|NP_064155.1| (NC_002512) pR49 [rat cytomegalovirus Maastricht]
 gb|AAF99148.1|AF232689_41 (AF232689) pR49 [rat cytomegalovirus Maastricht]
          Length = 525

 Score = 29.6 bits (65), Expect = 8.0
 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 3/33 (9%)
 Frame = +2

Query: 11  CYNKPYILAH---DRWCRRFPAWLVPRSRDSIR 100
           C N  Y++A    +R+CRR P +LVP  + S+R
Sbjct: 229 CGNPLYVMAKVFVERYCRRTPRFLVPLGQRSLR 261



  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  Mar 29, 2002  2:16 AM
  Number of letters in database: 284,333,007
  Number of sequences in database:  907,641
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 110,292,481
Number of Sequences: 907641
Number of extensions: 2014220
Number of successful extensions: 7674
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7669
length of database: 284,333,007
effective HSP length: 34
effective length of database: 253,473,213
effective search space used: 6083357112
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)