The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S_1_A02_T7.seq Fgr-S_1_A02_T7 0 0 0 1 126
         (126 letters)

Database: nr
           719,861 sequences; 228,039,490 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB30295.1|  (AK016546) putative [Mus musculus]                29  8.9

>dbj|BAB30295.1| (AK016546) putative [Mus musculus]
          Length = 883

 Score = 29.3 bits (64), Expect = 8.9
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 4/34 (11%)
 Frame = +1

Query: 25  NMETKPRGDGVALFRSHWELNLYAS----PTAEPTPAG 126
           NME  PR  GVA F    E + Y+     P AE TP+G
Sbjct: 243 NMEEDPRSAGVATFVLQEEFDRYSGYWWCPQAERTPSG 280



  Database: nr
    Posted date:  Jul 19, 2001 11:49 AM
  Number of letters in database: 228,039,490
  Number of sequences in database:  719,861
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 60,633,452
Number of Sequences: 719861
Number of extensions: 834598
Number of successful extensions: 395136993095
Number of sequences better than 10.0: 268722306
Number of HSP's better than 10.0 without gapping: 1850
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1863
length of database: 228,039,490
effective HSP length: 17
effective length of database: 215,801,853
effective search space used: 5179244472
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)