The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S_1_A03_T7.seq Fgr-S_1_A03_T7 0 0 0 1 185
         (185 letters)

Database: nr
           719,861 sequences; 228,039,490 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q9KQ23|ISPE_VIBCH  4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHR...    29  8.3

>sp|Q9KQ23|ISPE_VIBCH 4-DIPHOSPHOCYTIDYL-2-C-METHYL-D-ERYTHRITOL KINASE (CMK)
           (4-(CYTIDINE-5'-DIPHOSPHO)-2-C-METHYL-D-ERYTHRITOL
           KINASE)
 pir||E82109 kinase, GHMP family VC2182 [imported] - Vibrio cholerae  (group O1
           strain N16961)
 gb|AAF95327.1| (AE004289) kinase, GHMP family [Vibrio cholerae]
          Length = 295

 Score = 29.3 bits (64), Expect = 8.3
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = -3

Query: 129 KFPMALKSATPSPLGLVSMLPKMNPV*GGI 40
           K  MALK+A  SPLG    L K+ P+ GGI
Sbjct: 77  KAAMALKNAAQSPLGADIQLHKVLPMGGGI 106
Database: nr Posted date: Jul 19, 2001 11:49 AM Number of letters in database: 228,039,490 Number of sequences in database: 719,861 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.267 0.0410 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,154,712 Number of Sequences: 719861 Number of extensions: 1607166 Number of successful extensions: 3261 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3261 length of database: 228,039,490 effective HSP length: 37 effective length of database: 201,404,633 effective search space used: 4833711192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)