The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S_1_C05_T7.seq Fgr-S_1_C05_T7 0 0 0 1 270
         (270 letters)

Database: nr
           719,861 sequences; 228,039,490 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB04758.1|  (Z82001) PCPA [Streptococcus pneumoniae]          30  3.4
pir||T16584  hypothetical protein K09C4.8 - Caenorhabditis e...    30  5.8

>emb|CAB04758.1| (Z82001) PCPA [Streptococcus pneumoniae]
          Length = 708

 Score = 30.4 bits (67), Expect = 3.4
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = +2

Query: 11  GRGTLPWQFRGNAENKPFQAYTRIRIIDYIYETAFVRQQSF 133
           G G  P +F    + KPF   T+I + D ++    V  Q+F
Sbjct: 76  GNGVTPVEFEAGQDGKPFTIPTKITVGDKVFTVTEVASQAF 116



>pir||T16584 hypothetical protein K09C4.8 - Caenorhabditis elegans
 gb|AAA83618.1| (U43375) Similar to sulfatase [Caenorhabditis elegans]
          Length = 709

 Score = 29.6 bits (65), Expect = 5.8
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = +1

Query: 19  YITMAVQGKCREQAISGLHAHTHHRLHI*NGLC*AAEFPQVH 144
           Y+T  +    R   ++GL+ H HH +H  N  C   E+ +VH
Sbjct: 73  YVTTPICCPSRSTILTGLYVHNHH-VHTNNQNCTGVEWRKVH 113



  Database: nr
    Posted date:  Jul 19, 2001 11:49 AM
  Number of letters in database: 228,039,490
  Number of sequences in database:  719,861
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 118,641,601
Number of Sequences: 719861
Number of extensions: 2149981
Number of successful extensions: 395136995834
Number of sequences better than 10.0: 268722308
Number of HSP's better than 10.0 without gapping: 4472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4594
length of database: 228,039,490
effective HSP length: 65
effective length of database: 181,248,525
effective search space used: 4349964600
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)