The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S_8_D01_T7.seq Fgr-S_8_D01_T7 0 0 0 1 316
         (316 letters)

Database: nr
           722,277 sequences; 228,742,487 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB02262.1|  (AP002053) gene_id:T13O13.1~unknown protein...    49  7e-06
gb|AAK42360.1|  (AE006824) Pterin-4-alpha-carbinolamine dehy...    29  9.3

>dbj|BAB02262.1| (AP002053) gene_id:T13O13.1~unknown protein [Arabidopsis thaliana]
          Length = 249

 Score = 49.3 bits (116), Expect = 7e-06
 Identities = 22/34 (64%), Positives = 28/34 (81%)
 Frame = +3

Query: 21  LVLEITPFPVGTLTESDYRKAERLEMVLRMSASL 122
           LV+EITPFP G LTE+DY KAE+LE +LR  A++
Sbjct: 216 LVVEITPFPAGPLTENDYLKAEKLERILRSGANI 249
>gb|AAK42360.1| (AE006824) Pterin-4-alpha-carbinolamine dehydratase, putative
           [Sulfolobus solfataricus]
          Length = 114

 Score = 28.9 bits (63), Expect = 9.3
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 21  LVLEITPFPVGTLTESDYRKAERLEMVLRMSAS 119
           +V+E+T   VG LT+ DY+ A +L+ + +M  S
Sbjct: 82  VVVELTTHDVGGLTDLDYKLAIKLDELYKMKTS 114
Database: nr Posted date: Jul 23, 2001 8:52 PM Number of letters in database: 228,742,487 Number of sequences in database: 722,277 Lambda K H 0.318 0.135 0.00 Gapped Lambda K H 0.267 0.0410 4.94e-324 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136,932,609 Number of Sequences: 722277 Number of extensions: 2590627 Number of successful extensions: 5450 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5449 length of database: 228,742,487 effective HSP length: 80 effective length of database: 170,960,327 effective search space used: 4103047848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)