BLASTX 2.1.3 [Apr-1-2001]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query=
/phillip/projects/Xu/Fgr-S/seq_dir/blast_NcrP/Fgr-S_1_B04_T7.seq
         (312 letters)

Database: /phillip/Ncr/Ncr_P
           6531 sequences; 3,158,374 total letters

Searching..................................................done


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

NCU02187.1 NCU02187.1 predicted protein (69954 - 71793)                24  9.8
>NCU02187.1 NCU02187.1 predicted protein (69954 - 71793)
          Length = 421

 Score = 24.3 bits (51), Expect = 9.8
 Identities = 11/38 (28%), Positives = 20/38 (51%)
 Frame = -1

Query: 156 EPVILP*QYQALILIFVSALCIRLCTLLHVVIGCEQHN 43
           EPV++  Q   L+L+ +SAL +   + +   +    HN
Sbjct: 125 EPVVIVMQLSRLLLVGLSALSVAEASYIRKGVNVPHHN 162
  Database: /phillip/Ncr/Ncr_P
    Posted date:  May 20, 2002 12:05 PM
  Number of letters in database: 3,158,374
  Number of sequences in database:  6531
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1425741
Number of Sequences: 6531
Number of extensions: 19687
Number of successful extensions: 29
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of query: 104
length of database: 3,158,374
effective HSP length: 42
effective length of query: 61
effective length of database: 2,884,072
effective search space: 175928392
effective search space used: 175928392
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)