The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S2_1_B07_T7.seq Fgr-S2_1_B07_T7 0 0 0 1 295
         (294 letters)

Database: nr
           750,817 sequences; 238,836,854 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAB39002.1|  (AL034558) hypothetical protein, PFC0230c [...    30  3.4

>emb|CAB39002.1| (AL034558) hypothetical protein, PFC0230c [Plasmodium falciparum]
          Length = 3978

 Score = 30.4 bits (67), Expect = 3.4
 Identities = 17/54 (31%), Positives = 26/54 (47%)
 Frame = +3

Query: 102  HLIYPHRLISRARLILTKRRLTLPALRFFFQNTHK*CALFIVINKAEKGFSVTH 263
            H++YP + IS+ + +L+          F F N    C  + + NK EKG S  H
Sbjct: 2434 HILYPMKYISKKKDLLSNSYAKDDT--FLFLNKRMLCVYYNIHNKYEKGISGEH 2485



  Database: nr
    Posted date:  Sep 1, 2001  3:31 AM
  Number of letters in database: 238,836,854
  Number of sequences in database:  750,817
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 122,120,289
Number of Sequences: 750817
Number of extensions: 1989076
Number of successful extensions: 2954
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2953
length of database: 238,836,854
effective HSP length: 73
effective length of database: 184,027,213
effective search space used: 4416653112
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)