The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.3 [Apr-24-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Fgr-S3_1_F17_T7.seq Fgr-S3_1_F17_T7 LENGTH:480bp ;
DIRECTION:5 ; CLONE:Fgr-S3_1_F17 ; CLONELIB: n/a 
         (480 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF
           922,381 sequences; 289,601,141 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|NP_177883.1|  (NM_106408) hypothetical protein [Arabidop...    31   5.5  

>ref|NP_177883.1| (NM_106408) hypothetical protein [Arabidopsis thaliana]
 gb|AAG51671.1|AC010704_15 (AC010704) hypothetical protein; 73483-63403 [Arabidopsis thaliana]
          Length = 1303

 Score = 30.8 bits (68), Expect = 5.5
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 7/48 (14%)
 Frame = -3

Query: 136 VKVFLPEH-------DDYLDVFMKTVKDGRSAITKSWTRVVRAFCMEE 14
           VK FLP H       DD L++  KT+K       KSW   V   C E+
Sbjct: 800 VKSFLPRHGQVVRKIDDLLNILKKTLKSQGHDGIKSWCLFVLEICSED 847



  Database: All non-redundant GenBank CDS
  translations+PDB+SwissProt+PIR+PRF
    Posted date:  May 11, 2002  4:54 AM
  Number of letters in database: 289,601,141
  Number of sequences in database:  922,381
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 252,056,191
Number of Sequences: 922381
Number of extensions: 4588276
Number of successful extensions: 9572
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9460
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9571
length of database: 289,601,141
effective HSP length: 110
effective length of database: 188,139,231
effective search space used: 9218822319
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)