The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 1605_F08_K15ZS5.seq 1605_F08_K15ZS5 0 0 0 1 356
         (356 letters)

Database: nr
           705,144 sequences; 222,175,239 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||G75270  cation-transporting ATPase - Deinococcus radiod...    29  8.4

>pir||G75270 cation-transporting ATPase - Deinococcus radiodurans (strain R1)
 gb|AAF11997.1|AE002075_1 (AE002075) cation-transporting ATPase [Deinococcus radiodurans]
          Length = 847

 Score = 28.9 bits (63), Expect = 8.4
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -1

Query: 101 GSASYKTARISRTGTVKEAFVQVSDLVVADAWV 3
           G    +T  + +TGTV    ++V+D+VV   WV
Sbjct: 495 GLGEAQTVALDKTGTVTRGVMEVTDVVVDGRWV 527



  Database: nr
    Posted date:  Jun 30, 2001 11:40 PM
  Number of letters in database: 222,175,239
  Number of sequences in database:  705,144
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 145,132,141
Number of Sequences: 705144
Number of extensions: 2756947
Number of successful extensions: 5620
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 5547
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5620
length of database: 222,175,239
effective HSP length: 94
effective length of database: 155,891,703
effective search space used: 3741400872
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)