The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 1606_E11_I22ZS5.seq 1606_E11_I22ZS5 0 0 0 1 239
         (239 letters)

Database: nr
           705,144 sequences; 222,175,239 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||S75530  hydrogenase large chain - Synechocystis sp. (st...    33  0.69
sp|P10382|D5_DICDI  D5 PROTEIN >gi|84112|pir||S01975 gene D5...    30  3.4

>pir||S75530 hydrogenase large chain - Synechocystis sp. (strain PCC 6803)
 dbj|BAA18091.1| (D90911) hydrogenase large subunit [Synechocystis sp.]
 emb|CAA66212.1| (X97610) hydrogenase subunit [Synechocystis sp.]
          Length = 474

 Score = 32.7 bits (73), Expect = 0.69
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = -2

Query: 220 SSYFYHISVVVNIDSCNSKTRLLII*PKHININCRCAIRF*TAKTLLLMSIPSSTQIH 47
           SS+FYH + +V I +C     LL+  P  ++ NCR        + + +   P  T  H
Sbjct: 325 SSFFYHYARLVEILACLEAIELLMADPDILSKNCRAKAEINCTEAVGVSEAPRGTLFH 382



>sp|P10382|D5_DICDI D5 PROTEIN
 pir||S01975 gene D5 protein - slime mold (Dictyostelium discoideum) plasmid
           Ddp1
 emb|CAA31638.1| (X13273) D5 protein (AA 1-193) [Dictyostelium discoideum]
          Length = 193

 Score = 30.4 bits (67), Expect = 3.4
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = -2

Query: 136 HININCRCAIRF*TAKTLLLMSIPSSTQ--IHISLSFY 29
           H+ I+C   +R  T KT+L++   S  Q  +H+ L+FY
Sbjct: 138 HVQIHCATIVRMKTFKTILILKQQSVLQSMVHLILNFY 175



  Database: nr
    Posted date:  Jun 30, 2001 11:40 PM
  Number of letters in database: 222,175,239
  Number of sequences in database:  705,144
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 83,511,726
Number of Sequences: 705144
Number of extensions: 1296061
Number of successful extensions: 3470
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 3453
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3470
length of database: 222,175,239
effective HSP length: 55
effective length of database: 183,392,319
effective search space used: 4401415656
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)