The query sequence for this search has been filtered. Filtering
eliminates low complexity regions that commonly give spuriously high
scores that reflect compositional bias rather than significant
position-by-position alignment. Filtering can eliminate these potentially
confounding matches (e.g., hits against proline-rich regions or poly-A
tails) from the blast reports, leaving regions whose blast statistics
reflect the specificity of their pairwise alignment.

BLASTX 2.2.1 [Apr-13-2001]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 1606_F03_K06ZS5.seq 1606_F03_K06ZS5 0 0 0 1 478
         (467 letters)

Database: nr
           705,144 sequences; 222,175,239 total letters


                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T06645  hypothetical protein T20K18.220 - Arabidopsis t...    31  3.1

>pir||T06645 hypothetical protein T20K18.220 - Arabidopsis thaliana
 emb|CAB41004.1| (AL049640) putative protein [Arabidopsis thaliana]
 emb|CAB78329.1| (AL161535) putative protein [Arabidopsis thaliana]
          Length = 152

 Score = 31.2 bits (69), Expect = 3.1
 Identities = 13/31 (41%), Positives = 17/31 (53%)
 Frame = -3

Query: 123 NFKQKIMFITCVRRSTVSWVVECKEGYRNRK 31
           N K +  FI CV  +T +W   C +GY N K
Sbjct: 108 NPKSQYKFIRCVENNTDNWESSCLKGYGNEK 138



  Database: nr
    Posted date:  Jun 30, 2001 11:40 PM
  Number of letters in database: 222,175,239
  Number of sequences in database:  705,144
  
Lambda     K      H
   0.318    0.135     0.00 

Gapped
Lambda     K      H
   0.267   0.0410 4.94e-324 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 195,149,838
Number of Sequences: 705144
Number of extensions: 3922930
Number of successful extensions: 8455
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8292
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8453
length of database: 222,175,239
effective HSP length: 108
effective length of database: 146,019,687
effective search space used: 6862925289
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)